Protein Info for HMPREF1181_RS05445 in Bacteroides stercoris CC31F

Annotation: endonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR01083: endonuclease III" amino acids 5 to 197 (193 residues), 244.5 bits, see alignment E=3.5e-77 PF00730: HhH-GPD" amino acids 35 to 171 (137 residues), 86 bits, see alignment E=2.2e-28 PF00633: HHH" amino acids 101 to 126 (26 residues), 32 bits, see alignment (E = 7.3e-12)

Best Hits

Swiss-Prot: 47% identical to END3_RICPR: Endonuclease III (nth) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 90% identity to bhl:Bache_3054)

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>HMPREF1181_RS05445 endonuclease III (Bacteroides stercoris CC31F)
MRKKERYEKILAWFRENRPIAETELHYNNPYELLIAVILSAQCTDKRVNMITPALYRDFP
TPEALAATTPEVVYEYIRSVSYPNNKAKHLVGMAQMLVKDFNSQVPDTLEKLVKLPGVGR
KTANVIQSVVFNKAAMAVDTHVFRVSHRLGLVSDKCTTPFSVEKELVKYIPETEIPIAHH
WLILHGRYVCQARTPQCDNCGLQLMCKYYCRKYKVSKESNDGEE