Protein Info for HMPREF1181_RS05285 in Bacteroides stercoris CC31F

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 1 to 352 (352 residues), 331.5 bits, see alignment E=2.6e-103 PF03054: tRNA_Me_trans" amino acids 1 to 195 (195 residues), 197.7 bits, see alignment E=3.7e-62 PF00733: Asn_synthase" amino acids 3 to 71 (69 residues), 27 bits, see alignment E=7.4e-10 PF20259: tRNA_Me_trans_M" amino acids 200 to 263 (64 residues), 83.3 bits, see alignment E=1.5e-27 PF20258: tRNA_Me_trans_C" amino acids 273 to 352 (80 residues), 36.2 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 79% identical to MNMA1_BACTN: tRNA-specific 2-thiouridylase MnmA 1 (mnmA1) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 84% identity to bhl:Bache_3026)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>HMPREF1181_RS05285 tRNA 2-thiouridine(34) synthase MnmA (Bacteroides stercoris CC31F)
MNIAVLLSGGVDSSVVVHLLCEQGHRPSLFYIKIGKDDAEYMDCSAEEDLEMASAVARRY
GLSLEVVDLHREYWDNVAAYAIEKVSRGFTPNPDVMCNKLIKFGCFEQQVGRHFDFTATG
HYATTVLQNGKTWLGTALDPVKDQTDFLAQIDYLQVSKLMFPLGGLMKQEVRDIALKAQL
PSARRRDSQGICFLGRINYNDFVRRFLGEKEGRIVELETGKILGTHRGYCFHTIGQRKGL
GLSGGPWFVVRKDTDENVIYVSHGYDTELQYGHEFCMQDFHFITENPWEGIKDEIPVTFK
IRHTPGFIGGRLWQDETGYRIVSDEKLQGIAPGQFGVVYDEAAKLCIGSGEIRYSTPPNP
QCPLS