Protein Info for HMPREF1181_RS04865 in Bacteroides stercoris CC31F

Annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00070: ATP phosphoribosyltransferase" amino acids 2 to 182 (181 residues), 197 bits, see alignment E=2.6e-62 PF01634: HisG" amino acids 49 to 203 (155 residues), 175.4 bits, see alignment E=1.2e-55 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 185 to 282 (98 residues), 118.4 bits, see alignment E=1.3e-38 PF08029: HisG_C" amino acids 208 to 280 (73 residues), 105.6 bits, see alignment E=1.8e-34

Best Hits

Swiss-Prot: 89% identical to HIS1_BACTN: ATP phosphoribosyltransferase (hisG) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 89% identity to bhl:Bache_2988)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>HMPREF1181_RS04865 ATP phosphoribosyltransferase (Bacteroides stercoris CC31F)
MLRIAVQAKGRLFDETMSFLEESDIKLSATKRTLLVQSSNFPLEVLFLRDDDIPQTVATG
VADLGIVGENEFMEKAEDAEIVKRLGFSKCRLSLALPKDIEYTGPQWFEGKKIATSYPGI
LSRYLKEQGVRAEIHVITGSVEVSPGIGLADAIFDIVSSGSTLVSNRLKEVEVVMKSEAL
LIGNKNMSEEKKEILDELLFRMNAVKTAEDKKYVLMNAPKDRLDEIIAVLPGMKSPTVMP
LAQEGWCSVHTVLDEKCFWEIIGKLKALGAEGILVLPIEKMIL