Protein Info for HMPREF1181_RS04785 in Bacteroides stercoris CC31F

Annotation: Rne/Rng family ribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00757: ribonuclease, Rne/Rng family
  • amino acids 14 to 438 (425 residues), 441.8 bits, E=1.2e-136
• PF10150: RNase_E_G
  • amino acids 143 to 414 (272 residues), 325.7 bits, E=1.2e-101

Best Hits

KEGG orthology group: K08301, ribonuclease G [EC: 3.1.26.-] (inferred from 97% identity to bfr:BF1552)

Predicted SEED Role

"Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)" in subsystem Bacterial Cell Division or RNA processing and degradation, bacterial (EC 3.1.4.-)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ether lipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.- or 3.1.4.-

Protein Sequence (524 amino acids)

>HMPREF1181_RS04785 Rne/Rng family ribonuclease (Bacteroides stercoris CC31F)
MTSELVVDVQPKEVSIALLEDKSLVELQSEGRNISFSVGNMYLGRVKKLMPGLNACFVDV
GYEKDAFLHYLDLGPQFNSLEKYVKQTLSDKKKLNPITKATILPDLEKDGTVSNTLKVGQ
EVVVQIVKEPISTKGPRLTSELSFAGRYLVLIPFNDKVSVSQKIKSSEERARLKQLLMSI
KPKNFGVIVRTVAEGKRVAELDGELKVLLKHWEEAIVKVQKATKFPTLIYEETSRAVGLL
RDLFNPSFENIYVNNEAVFNEIKDYVTLIAPERAGIVKLYKGQLPIYDNFGITKQIKSSF
GKTVSYKSGAYLIIEHTEALHVVDVNSGNRIKNANGQEANALEVNLGAADELARQLRLRD
MGGIIVVDFIDMNEAENRQKLYERMCANMQKDRARHNILPLSKFGLMQITRQRVRPAMDV
NTTETCPTCFGKGTIKSSILFTDTLESKIDYLVNKLKIKKFSLHIHPYIAAYINQGVLSL
KRKWQMKYGFGIKIIPSQKLAFLEYVFYDPQGEEIDMKEEIEIK