Protein Info for HMPREF1181_RS04775 in Bacteroides stercoris CC31F

Annotation: A/G-specific adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01084: A/G-specific adenine glycosylase
  • amino acids 4 to 264 (261 residues), 311.8 bits, E=2.3e-97
• PF00730: HhH-GPD
  • amino acids 32 to 145 (114 residues), 70 bits, E=2e-23
• PF14815: NUDIX_4
  • amino acids 228 to 344 (117 residues), 57.2 bits, E=1.5e-19

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 79% identity to bhl:Bache_2948)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Protein Sequence (346 amino acids)

>HMPREF1181_RS04775 A/G-specific adenine glycosylase (Bacteroides stercoris CC31F)
MNRLTEALLDWYADNKRDLPWRGTTDPYRIWISEIILQQTRVVQGYEYFLRFIRRFPDVR
TLASASEDEVLKYWQGLGYYSRARNLHAAAKSMNGKFPESYQEVRALKGVGDYTAAAICS
IAYNMPYAVVDGNVYRVLSRYCGIDVPIDSTEGKKLFAALADEMLDKSRPAAYNQAIMDF
GAIQCTPQSPNCMFCPLADSCSALSKGQVMQLPVKQHRTKTSNRYFNYIYVRMGACTFIH
KRTADDIWKNLFELPLVEADRNLSEEEFLSSASFRSLIAEGEVPEVRLVFRNVKHVLSHR
VIYANFYEVVLPENSRSFSEYQCIRMEDLEQYPVSRLVHAFLEKYL