Protein Info for HMPREF1181_RS04540 in Bacteroides stercoris CC31F

Annotation: NADH peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF21349: RUBY_RBDX" amino acids 4 to 32 (29 residues), 56.2 bits, see alignment 2.7e-19 PF00210: Ferritin" amino acids 64 to 117 (54 residues), 26.1 bits, see alignment E=1.1e-09 PF02915: Rubrerythrin" amino acids 66 to 130 (65 residues), 44.7 bits, see alignment E=2.6e-15

Best Hits

Swiss-Prot: 69% identical to RRBR1_CLOAB: Reverse rubrerythrin-1 (rbr3A) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: None (inferred from 96% identity to bhl:Bache_2879)

Predicted SEED Role

"Rubrerythrin" in subsystem Oxidative stress or Rubrerythrin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>HMPREF1181_RS04540 NADH peroxidase (Bacteroides stercoris CC31F)
MKKFRCTVCGYVYEGDAAPEKCPLCKAPASKFVEVEEAQAGGPLVFADEHVIGVAKGCDD
EMIKDLNNHFMGECTEVGMYLAMSRQADREGYPEVAEAFKRYAWEEAEHAAKFAELLGDC
VWDTKTNLEKRMNAESGACEDKKRIATRAKALNLDAIHDTVHEMAKDEARHGKGFEGLYN
RYFKK