Protein Info for HMPREF1181_RS04305 in Bacteroides stercoris CC31F

Annotation: sulfate adenylyltransferase subunit CysD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02039: sulfate adenylyltransferase, small subunit
  • amino acids 10 to 303 (294 residues), 504.3 bits, E=6.6e-156
• PF01507: PAPS_reduct
  • amino acids 30 to 257 (228 residues), 195.6 bits, E=3.6e-62

Best Hits

Swiss-Prot: 96% identical to CYSD_PARD8: Sulfate adenylyltransferase subunit 2 (cysD) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 96% identity to bhl:Bache_2852)

MetaCyc: 69% identical to sulfate adenylyltransferase subunit 2 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• sulfate activation for sulfonation (2/2 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (8/12 steps found)
• assimilatory sulfate reduction I (2/4 steps found)
• assimilatory sulfate reduction IV (2/4 steps found)
• assimilatory sulfate reduction II (1/3 steps found)
• assimilatory sulfate reduction III (1/3 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (4/10 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (2/12 steps found)
• superpathway of seleno-compound metabolism (5/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Protein Sequence (303 amino acids)

>HMPREF1181_RS04305 sulfate adenylyltransferase subunit CysD (Bacteroides stercoris CC31F)
MKEEYKLSHLKELEAESIHIIREVAAEFENPVMLYSIGKDSSVMVRLAEKAFAPGKVPFP
LMHIDSKWKFKEMIQFRDEYARKYGWNLIVESNMEAFEAGVGPFTHGSKVHTDLMKTQAL
LHALDKYKFDAAFGGARRDEEKSRAKERIFSFRDKFHQWDPKNQRPELWDIYNARVHKGE
SIRVFPLSNWTELDIWQYIRLENIPIVPLYFAKERPCVEIDGNLIMADDDRLPEQYREKI
EMRMVRFRTLGCWPLTGAVESSADTIEKIVEEMMTTTKSERTTRVIDFDQEASMEQKKRE
GYF