Protein Info for HMPREF1181_RS03830 in Bacteroides stercoris CC31F

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 4 to 166 (163 residues), 53.9 bits, see alignment E=7.9e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>HMPREF1181_RS03830 acyltransferase family protein (Bacteroides stercoris CC31F)
MLEKKKGISLLISLCWATFTALTGLAEERIWNSFFLQYLWEFVLGMWLAKVYFENSENIK
VPKVSVLLVTMIIGLGLTGIAGFVGGIWKSYNDIPSLIGYMSMALIFYQVGVKWLNKFFE
YTNKISYEWYLVHILVFTIYFRFARGVLPFFVDWVILMFISYLVAIGYQILVNRFIKI