Protein Info for HMPREF1181_RS03505 in Bacteroides stercoris CC31F

Annotation: L-rhamnose/proton symporter RhaT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details PF06379: RhaT" amino acids 4 to 340 (337 residues), 198.3 bits, see alignment E=1.1e-62

Best Hits

KEGG orthology group: K02856, L-rhamnose-H+ transport protein (inferred from 80% identity to bth:BT_3765)

Predicted SEED Role

"L-rhamnose-proton symporter" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>HMPREF1181_RS03505 L-rhamnose/proton symporter RhaT (Bacteroides stercoris CC31F)
MNTLIGLLIIAVGSFGQSSSYVPINKVKGWSWENFWLVQGIFAWLVFPLLGALLAIPADG
SLIELWGAGGALPAIIYGVLWGVGGLTFGLSMRYLGVALGQSIALGTCAGFGTLFPALFA
GKDLLHGDGLMLLIGVCITLAGIAIIGYAGSLRSRNMSEEEKKAAVKDFALTKGLLVALL
AGVMSACFALGLDAGTPIKEAALAGGVAPLYAGLPVIFLVTLGGFCTNAAYCIQQNIKNR
TGKEYLSVSGDVLVNNVLFCALAGVLWYSQFFGLEMGKSFLGGSPILLAFSWSILMSLNV
TFSNVWGILLKEWKGCGSRTIGVLILGLAVLIASIIVVAMAQA