Protein Info for HMPREF1181_RS03445 in Bacteroides stercoris CC31F

Annotation: aspartate aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF00202: Aminotran_3" amino acids 12 to 373 (362 residues), 347.5 bits, see alignment E=9.1e-108 PF00155: Aminotran_1_2" amino acids 54 to 340 (287 residues), 25.8 bits, see alignment E=6.2e-10

Best Hits

KEGG orthology group: K00818, acetylornithine aminotransferase [EC: 2.6.1.11] (inferred from 89% identity to bhl:Bache_0283)

Predicted SEED Role

"Acetylornithine aminotransferase (EC 2.6.1.11)" in subsystem Arginine Biosynthesis extended (EC 2.6.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>HMPREF1181_RS03445 aspartate aminotransferase family protein (Bacteroides stercoris CC31F)
MKLFDVYPLFDINIVKGKGCHVWDDKGTEYLDLYGGHAVISIGHAHPHYVEMLGKQVATL
GFYSNSVINELQQQLAERLGKVCGYNDYSLFLINSGAEANENALKLASFHNGRTRVVSFS
KAFHGRTSLAVEATDNPKIIAPINNCGHVTYLPLNDTEAMKAELAKGDVCAVIIEGIQGV
GGIQLPTDEFMQALRKACTEHNTVLILDEIQSGYGRSGKFFAHQYNGIKADIITVAKGIG
NGFPMAGVLISPMFTPVYGQLGTTFGGNHLACSAALAVLDVIEQEALVENAAQVGAYLME
ELKKFPQIKEVRGRGLMIGLEFEEPVKELRLRLLKEQHVFTGVSGTNVLRLLPPLCLGMD
EANLFLERFKKAL