Protein Info for HMPREF1181_RS03370 in Bacteroides stercoris CC31F

Annotation: outer membrane protein assembly factor BamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 879 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 837 to 855 (19 residues), see Phobius details PF07244: POTRA" amino acids 47 to 119 (73 residues), 27.6 bits, see alignment E=3.8e-10 amino acids 122 to 200 (79 residues), 38.8 bits, see alignment E=1.2e-13 amino acids 204 to 292 (89 residues), 40.4 bits, see alignment E=4.1e-14 amino acids 295 to 376 (82 residues), 36.2 bits, see alignment E=8.4e-13 amino acids 380 to 451 (72 residues), 40.6 bits, see alignment E=3.4e-14 TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 48 to 879 (832 residues), 305.1 bits, see alignment E=5.7e-95

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 91% identity to bhl:Bache_0323)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (879 amino acids)

>HMPREF1181_RS03370 outer membrane protein assembly factor BamA (Bacteroides stercoris CC31F)
MYYRISSILVTFICLFSCVLTSSAQDTSNTDETEKPVILYSGTPKKYEIADIKVVGAKNY
EDYVIIGLSGLSKGQTITVPGDEITQACKRYWRHGLFSDVQVTADKIEGDRIWLTIHLTM
RPRVSDIRYHGVKKSEREDLEARVGLIKGNQITPNLIDRAKTLIKRYFDDKGFKNADIII
TQKDDPNNENQVLVDINIDKKEKVKVHQITITGNQAITTKKLKRVMKKTNEKGKLLNLFR
TKKFVEENFEADKQLIIDKYNELGYRDAMIVKDSIKSYDDRTVDIFMEIEEGQKYYLRNV
TWVGNTLYPSEQLNFLLRMKKGDVYNQKLLEERTSTDEDAIGNLYYNNGYLFYSLDPVEV
NIVGDSIDLEMRIFEGRQATINKVSINGNDRLYENVVRRELRTRPGQLFSREDLMRSMRE
IQQMGHFDPEQIQPDIQPKPEDGTVDIGYDLVSKANDQVEFSAGWGQTGIIGKLSLKFTN
FSVANLLHPGENYRGILPQGDGQTLTISGQTNAKYYQSYSVSFYDPWFGGKRPNAFSVSA
FYSRQTDISSRYYNDAYMNSYYNSYYSGMYGYGMYNYGNYNNYENYYDPDKSIQMWGLAV
MFGKRLKWPDDYFQFTAELSYQRYILSDWQYFPVTNGKCNNLSINLTLSRSSIDNPIYPR
QGSEFSLSAQLTPPYSLFDGTDYSKYSTSNQDDMNKMHKWIEYHKWKFKSKVYIPLMDPI
AVKRTPVLMGRVEFGLLGHYNKYKKSPFETFDVGGDGMTGYSSYATESVALRGYENSSLT
PYGYEGYAYARLGLELRYPLMLETSTSIYALTFVEAGNAWHDVNKFNPFDLKRSAGVGVR
IFLPMIGMMGIDWAYGFDKVLGSKQYGGSQFHFILGQEF