Protein Info for HMPREF1181_RS03255 in Bacteroides stercoris CC31F

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR01205: D-alanine--D-alanine ligase" amino acids 5 to 322 (318 residues), 268.1 bits, see alignment E=4.6e-84 PF01820: Dala_Dala_lig_N" amino acids 5 to 106 (102 residues), 68.3 bits, see alignment E=2.7e-22 PF02655: ATP-grasp_3" amino acids 116 to 291 (176 residues), 34.3 bits, see alignment E=7.5e-12 PF02786: CPSase_L_D2" amino acids 116 to 291 (176 residues), 34 bits, see alignment E=6.5e-12 PF07478: Dala_Dala_lig_C" amino acids 124 to 321 (198 residues), 163.5 bits, see alignment E=1.5e-51 PF02222: ATP-grasp" amino acids 125 to 289 (165 residues), 31.9 bits, see alignment E=3e-11 PF13535: ATP-grasp_4" amino acids 153 to 292 (140 residues), 33.7 bits, see alignment E=8.3e-12

Best Hits

Swiss-Prot: 85% identical to DDL_BACTN: D-alanine--D-alanine ligase (ddl) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 88% identity to bhl:Bache_0334)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>HMPREF1181_RS03255 D-alanine--D-alanine ligase (Bacteroides stercoris CC31F)
MKRTIAIVCGGDTSEFEVSLRSAQGIYSFIDKERYTLYIVEMRGTDWHVQLPDGTKTLVD
RNDFSFRLDGAKVVFDFAYITIHGTPGEDGRLQGYFDMLHIPYSCCGVLAAALTYDKFAC
NQYLKAFGVRIADSLLLRQGQSVSDEDVIGKIGLPCFIKPSLGGSSFGVTKVNVKEQIQP
AIAKAFAEAKEVLVEAFMDGMEITCGCYKTKEKSVVFPITEVVSHNEYFDYKAKYNGESD
EITPARIPDELRDRVQKLTSAIYDILGASGIIRVDYIITEGEKINLLEVNTTPGMTATSF
IPQQVRAANLDIKDVMTDIIENQF