Protein Info for HMPREF1181_RS02860 in Bacteroides stercoris CC31F

Annotation: dUTP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 TIGR00576: dUTP diphosphatase" amino acids 8 to 142 (135 residues), 177.1 bits, see alignment E=8.2e-57 PF00692: dUTPase" amino acids 11 to 142 (132 residues), 107.1 bits, see alignment E=2.8e-35

Best Hits

Swiss-Prot: 91% identical to DUT_BACTN: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 91% identity to bth:BT_3461)

MetaCyc: 48% identical to dUTP diphosphatase (Escherichia coli K-12 substr. MG1655)
dUTP diphosphatase. [EC: 3.6.1.23, 3.6.1.9]

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.9

Use Curated BLAST to search for 3.6.1.23 or 3.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>HMPREF1181_RS02860 dUTP diphosphatase (Bacteroides stercoris CC31F)
MTVRIINKSKHPLPAYATELSAGMDIRANLSEPIALEPLQRCLVPTGLYIALPAGFEAQI
RPRSGLAIKKGISVLNSPGTIDADYRGEICIILVNLSSETFMIEDGERIAQMVIARHEQA
VWQEVDVLDETERGAGGFGHTGV