Protein Info for HMPREF1181_RS02740 in Bacteroides stercoris CC31F

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 9 to 111 (103 residues), 57.9 bits, E=1.6e-19
• PF08245: Mur_ligase_M
  • amino acids 117 to 294 (178 residues), 67.3 bits, E=2.7e-22
• PF02875: Mur_ligase_C
  • amino acids 314 to 399 (86 residues), 57.7 bits, E=1.8e-19

Best Hits

Swiss-Prot: 77% identical to MURC_BACV8: UDP-N-acetylmuramate--L-alanine ligase (murC) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 88% identity to bhl:Bache_0484)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Protein Sequence (461 amino acids)

>HMPREF1181_RS02740 UDP-N-acetylmuramate--L-alanine ligase (Bacteroides stercoris CC31F)
MNIETIKSVYFVGAGGIGMSALIRYFLSKGKFVAGYDRTPSELTGHLIAEGAQIHYEENT
GLIPENCKDKESTLVVYTPAIPQEHAELAYFRENGFEIHKRSQVLGTITRSSKGLCVAGT
HGKTTTSTMAAHLFHQSHVGCTAFLGGISKNYGTNLLLSPASPYTVIEADEFDRSFHWLS
PYMSVITSTDPDHLDIYGTREAYLESFRHYTTLIQPGGALIIRKGLALQPDVQPGVRTYT
YSRDEGDFHAENIRIGNGEIVIDFIAPDTRINDIRLGVPIGINIENGVAAMALAHLNGVT
DEEIRQGMASFRGVDRRFDFKIKTDRLVFLSDYAHHPAEIAQSVKSIRELYRDKKITAIF
QPHLYTRTRDFYKDFADSLSLLDEVILTEIYPAREQPIPGVSSQLIYDNLRPGIEKCICR
KEDIPDLLSKKPVEVLIVLGAGDLDNYVPSIARLLEQRSKA