Protein Info for HMPREF1181_RS02050 in Bacteroides stercoris CC31F

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details PF07168: Ureide_permease" amino acids 41 to 155 (115 residues), 40.5 bits, see alignment E=2.3e-14 amino acids 169 to 329 (161 residues), 69.7 bits, see alignment E=3e-23 PF06800: Sugar_transport" amino acids 74 to 321 (248 residues), 36.6 bits, see alignment E=5.1e-13 PF07857: TMEM144" amino acids 164 to 321 (158 residues), 35.2 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: None (inferred from 75% identity to bth:BT_2809)

Predicted SEED Role

"L-rhamnose-proton symporter" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>HMPREF1181_RS02050 hypothetical protein (Bacteroides stercoris CC31F)
MFIVDSYSLAVIFCVVTMLCWGSWGNTQKLAGKTWRYELFYWDYVIGILAFSLLLGFTLG
SKGDTGRGFVEDLKQISMANYASAFTGGVIFNLSNILLSASVSMAGLTVAFPLGVGIALV
LGVFVNYFGEPKGDAVILFSGVALVVLAIIFNAIAAGKMNQKGNSTNKKGIIIAIIAGVL
MSFFYRFVAAAMDLNNFESPTPTMATPYSAFFIFAIGIFISNFIINTIVMKKPFVGTPVS
YKEYFQGKFSTHMVGVLGGAIWGLGTALSYIAAGKAGAAISYALGQGAPMIAALWGIFIW
KEFKGSSRTVNILLACMFVLFISGLGAIIISGAN