Protein Info for HMPREF1181_RS01920 in Bacteroides stercoris CC31F

Annotation: quinolinate synthase NadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 34 to 340 (307 residues), 387 bits, E=3e-120
• PF02445: NadA
  • amino acids 40 to 338 (299 residues), 419 bits, E=4.7e-130

Best Hits

Swiss-Prot: 57% identical to NADA_SYNE7: Quinolinate synthase A (nadA) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 92% identity to bth:BT_3164)

MetaCyc: 41% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (6/6 steps found)
• aspartate superpathway (19/25 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Protein Sequence (345 amino acids)

>HMPREF1181_RS01920 quinolinate synthase NadA (Bacteroides stercoris CC31F)
MGKKIWIYLSTLLTAHHHYQRIFKERREIKIIIMDNLIEAIKQLKKEKNAIILGHYYQKG
EIQDIADYVGDSLALAQWAAKTEADIIVMCGVHFMGETAKVLCPDKKVLVPDMAAGCSLA
DSCPADKFAQFVKEHPGHTVISYVNTTAAVKAVTDVVVTSTNARQIVESFPEDEKIIFGP
DRNLGNYINSVTGRNMLLWDGACHVHEQFSVEKIVELKQQHPGAVVLAHPECKSTVLKLA
DVVGSTAALLKYAVAHPEKEYIVATESGILHEMQKKCPQTKFIPAPPNDSTCACNECNFM
RLNTLEKLYNCLKDESPEIKVDAEIAEKAVKPIKRMLEISAKLGL