Protein Info for HMPREF1181_RS01780 in Bacteroides stercoris CC31F

Annotation: acetyl-CoA hydrolase/transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03458: succinate CoA transferase
  • amino acids 3 to 489 (487 residues), 765.4 bits, E=1.1e-234
• PF02550: AcetylCoA_hydro
  • amino acids 6 to 211 (206 residues), 121.1 bits, E=6.4e-39
• PF13336: AcetylCoA_hyd_C
  • amino acids 317 to 458 (142 residues), 152.2 bits, E=1.1e-48

Best Hits

Swiss-Prot: 51% identical to SCPC_ECOLI: Propionyl-CoA:succinate CoA transferase (scpC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to bhl:Bache_0741)

MetaCyc: 51% identical to propionyl-CoA:succinate CoA transferase (Escherichia coli K-12 substr. MG1655)
RXN0-268 [EC: 2.8.3.27]

Predicted SEED Role

"Propionyl-CoA:succinyl-CoA transferase"

MetaCyc Pathways

• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• pyruvate fermentation to propanoate I (5/7 steps found)
• conversion of succinate to propanoate (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• L-glutamate degradation VIII (to propanoate) (5/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.27

Protein Sequence (498 amino acids)

>HMPREF1181_RS01780 acetyl-CoA hydrolase/transferase family protein (Bacteroides stercoris CC31F)
MAFNYISAAEAASLIKHGYNIGLSGFTPAGTAKAVTAELAKIAEAEHAKGNPFQVGIFTG
ASTGDSCDGVLSRVKAIRYRAPYTTNPDFRKAVNNGEIAYNDIHLSQMAQEVRYGFMGKV
NVAIIEACEVTPDGKIYLTAAGGIAPTICCLADQIIIELNAAHSKNAMGLHDVYEPLDPP
YRREIPIFKPSDRIGQPYIQVDPKKIVGIVETNWPDEARSFAAADPLTDKIGQNVADFLA
ADMKRGIIPSTFLPLQSGVGNIANAVLGALGRDKTIPAFEMYTEVIQNSVIGLIREGRVK
FGSACSLTVTNDCLNGIYEDMDFFRDKLVLRPSEISNSPEVVRRLGIISINTAIEADLYG
NVNSTHIGGTKMMNGIGGSGDFTRNAYISIFTCPSVAKEGKISAIVPMVSHVDHSEHDVN
IIVTEQGVADLRGKSPKERAQAIIENCVHPDYKNILWDYLKLTDGKAQTPHSMRAALAMH
AELAKSGDMKNVDWAQYK