Protein Info for HMPREF1181_RS01725 in Bacteroides stercoris CC31F

Annotation: FtsX-like permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 12 to 20 (9 residues), see Phobius details amino acids 41 to 41 (1 residues), see Phobius details transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details PF18075: FtsX_ECD" amino acids 54 to 146 (93 residues), 64.3 bits, see alignment E=1.3e-21 PF02687: FtsX" amino acids 170 to 282 (113 residues), 40.8 bits, see alignment E=2.1e-14

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 89% identity to bhl:Bache_0747)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>HMPREF1181_RS01725 FtsX-like permease family protein (Bacteroides stercoris CC31F)
MNKKAKNKSVPCFDMQFITSSISTTLVLLLLGLVVFFVLGAHNLSVYVKENINFSILISD
DMKESDILKLQKKLDKEPFVKETEYISKKQALREQTEAMGTDPQEFLGYNPFTASIEIKL
HSGYANSDSIAKIEKKIRKNTDIQEVLYQKDLIDAVNENIRNISLMLLGLAVILTFISFA
LINNTIRLTIYSKRFLIHTMKLVGASWGFIRRPFLRRNFRIGVLSAVIADAILWGAAYWL
VSYEPELIRVITPEVMLLVSVSVLVFGVLITWLCALLSINKYLKMKASTLYYI