Protein Info for HMPREF1181_RS01705 in Bacteroides stercoris CC31F

Annotation: tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 93% identical to QUEA_BACFN: S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queA) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 95% identity to bhl:Bache_0751)

MetaCyc: 45% identical to S-adenosylmethionine--tRNA ribosyltransferase-isomerase (Clostridioides difficile)
RXN0-1342 [EC: 2.4.99.17]

Predicted SEED Role

"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)

MetaCyc Pathways

queuosine biosynthesis I (de novo) (3/4 steps found)
queuosine biosynthesis III (queuosine salvage) (2/5 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 2.4.99.17 or 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>HMPREF1181_RS01705 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA (Bacteroides stercoris CC31F)
MKLSQFKFKLPEEKIALHPTRYRDESRLMVLHRKTGEIEHRMFKDILDYFDDKDVFIFND
TKVFPARLYGNKEKTGARIEVFLLRELNEELRLWDVLVDPARKIRIGNKLYFGEDDSMVA
EVIDNTTSRGRTLRFLYDGPHDEFKKALYALGETPLPHSIINRPVEPEDSERFQSIFARN
EGAVTAPTASLHFSRELMKRMEIKGIDFAYITLHAGLGNFRDIDVEDLTKHKTDSEQMIV
TEEAVKVVNRAKDLNRQVCAVGTTVMRAIESTVSTDGHLKEYEGWTNKFIFPPYDFTVAN
AMVSNFHMPLSTLLMIVAAFGGYEQVMEAYNVALKEDYRFGTYGDAMLITDR