Protein Info for HMPREF1181_RS01555 in Bacteroides stercoris CC31F

Annotation: pyridoxamine 5'-phosphate oxidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12900: Pyridox_ox_2
  • amino acids 9 to 149 (141 residues), 71.8 bits, E=8.9e-24
• PF01243: Putative_PNPOx
  • amino acids 11 to 106 (96 residues), 45 bits, E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 73% identity to bhl:Bache_0791)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• pyridoxal 5'-phosphate salvage I (2/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (2/8 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (2/9 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Protein Sequence (159 amino acids)

>HMPREF1181_RS01555 pyridoxamine 5'-phosphate oxidase family protein (Bacteroides stercoris CC31F)
MKTITITNRSQIEDIIRKCPYCTVGIIDGEGNPYVIPMNFAWENDTIYLHSGPEGSKVEM
VARHPQVCITFCEGHELVYIHKQIACSYSMKSRSVICKGKVRFIEDMDEKRRILDLLMKQ
YTDNACSYAEPAVRNVKIWEVKVDEISCKSFGLRPSELK