Protein Info for HMPREF1181_RS01550 in Bacteroides stercoris CC31F

Annotation: ribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 TIGR02063: ribonuclease R" amino acids 23 to 719 (697 residues), 828 bits, see alignment E=6.8e-253 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 78 to 718 (641 residues), 535.9 bits, see alignment E=1.4e-164 PF08206: OB_RNB" amino acids 162 to 216 (55 residues), 27.1 bits, see alignment 6.9e-10 PF17876: CSD2" amino acids 167 to 241 (75 residues), 84.9 bits, see alignment E=8.2e-28 PF17849: OB_Dis3" amino acids 173 to 234 (62 residues), 37.9 bits, see alignment 3.9e-13 PF00773: RNB" amino acids 263 to 590 (328 residues), 372 bits, see alignment E=7e-115 PF00575: S1" amino acids 637 to 715 (79 residues), 34.8 bits, see alignment E=4.3e-12

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 93% identity to bhl:Bache_0793)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (719 amino acids)

>HMPREF1181_RS01550 ribonuclease R (Bacteroides stercoris CC31F)
MAKTKKEKKEKKAGKRMKKKELVKALLDFFHVKQDEVLSLKYIFEQLHLTTHPLKMLCMD
ILSELSDDDYITEVDKHKYKLNNHGVEMTGTFQRKSNGKNSFIPEGGGDPIFIAERNSAH
AMAGDKVRIAFYAKRRGREAEGEVIEILERANDTFVGTLEVAKSYAFLVTENRTLANDIF
IPKEKLKGGKTGDKAIVKVVEWPDKAKNPIGQVIDILGKAGDNTTEMHAILAEFGLPYVY
PASVEKAADRIPAEIPAEEYAKREDFRNVTTFTIDPKDAKDFDDALSIRKLKDNLWEVGV
HIADVTHYVTEGSIIDKEAEKRATSVYLVDRTIPMLPERLCNFICSLRPDEEKLAYSAIF
EMTDKGEVKNSRIVHTVIKSDRRFTYEEAQQIIETKEGDFKEEILKLDSLAKILREKRFT
AGAINFDRYEVKFEIDEQGKPVSVYFKESKDANKLVEEFMLLANRTVAEKIGRVPKSKKP
KVFPYRIHDLPDPEKLDNLAQFIARFGYKLRTGGTKTDVSKSINHLLDDIQGKKEENLIE
TVSIRAMQKARYSVHNIGHYGLAFDYYTHFTSPIRRYPDMLVHRLLTKYLDLGGRSVSEQ
KYEALCEHSSSMEQIAANAERASIKYKQVEYMTERLGQTYDGVISGVTEWGLYVELNENK
CEGMIPIRDLDDDYYEFDEKNYCLRGRRKKRTYSLGDAITIKVARANLEKKQLDFALVE