Protein Info for HMPREF1181_RS01305 in Bacteroides stercoris CC31F

Annotation: N-acetylneuraminate synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF03102: NeuB" amino acids 44 to 271 (228 residues), 209.1 bits, see alignment E=7.5e-66 PF08666: SAF" amino acids 289 to 346 (58 residues), 34.9 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: None (inferred from 74% identity to bth:BT_1714)

MetaCyc: 74% identical to 2-keto-3-deoxy-D-glycero-D-galacto-nononate-9-phosphate synthase (Bacteroides thetaiotaomicron VPI-5482)
RXN-9991 [EC: 2.5.1.132]

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.132 or 2.5.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>HMPREF1181_RS01305 N-acetylneuraminate synthase family protein (Bacteroides stercoris CC31F)
MKSTYIIGEIGQNHNGSVDIAKLIVDLVSRPVREEVFNLELRPMDAVKMTKRDLNEELTD
SQMNRPYDSPHSFGRTYGEHRAYLELTDEEHFEVYKHAKSLGLDFVETLCSKGCMSLLKL
FTPDRLKVASRDLTNLPLLEVMAETRIPIILSTGMAGKKELDDALEVITRYHNDISILHC
VSQYPTQPDNLNLKTITYLKRHYGQYHIGFSDHTIGIAAPVVAVGMGAEIIEKHVTIDRR
MKGTDQQGSLGPDGVNRMIRDIRIAEHWLGREGLYIDPAVSAAKVKLERSIATNKALHPG
DIITEEDIHLLSPGDGFKWAERDKVVGRRVRKEIPRNEIIYPSLIEK