Protein Info for HMPREF1181_RS01260 in Bacteroides stercoris CC31F

Annotation: AhpC/TSA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF14289: DUF4369" amino acids 26 to 116 (91 residues), 56.9 bits, see alignment E=3.8e-19 PF00578: AhpC-TSA" amino acids 203 to 321 (119 residues), 32.9 bits, see alignment E=8.3e-12 PF13905: Thioredoxin_8" amino acids 227 to 320 (94 residues), 42.5 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 70% identity to bhl:Bache_0874)

Predicted SEED Role

"Thiol:disulfide interchange protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>HMPREF1181_RS01260 AhpC/TSA family protein (Bacteroides stercoris CC31F)
MKNIYLAYFLIIMLSACGGKSSDTVSLSGEIKGLGNDTLYIYGADEMYDRMDTLPVENGK
FSKTLSPDTLVAAWLLFSDGSRYPFFMDKGDKIHIKGSAAELNSMEITGNPHNEELTAFR
KELKGLGKPSEKVLEEKAGKFINEHHSSLASIYLLDKYFAQKEKPDYTLIKQLTEHMTGE
LKDRPYIDGLLDRIQEEEKAATGKTAAYFRLPNAEGKQITRSNFKDQYLLIHFWASWDTV
SRDSNAVYRRIYRKGQKNKKFALLGISLDLNKDNWKKAIETDTLKWEQACDLSGWETGVV
KQLAIRTLPANVLLSPSGRIEGKNLSETAIEKKLKDIEEQEKKEKKREIENERKKKR