Protein Info for HMPREF1181_RS01210 in Bacteroides stercoris CC31F

Annotation: S-ribosylhomocysteine lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02664: LuxS
  • amino acids 3 to 151 (149 residues), 201.2 bits, E=4e-64

Best Hits

Swiss-Prot: 86% identical to LUXS_BACV8: S-ribosylhomocysteine lyase (luxS) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K07173, S-ribosylhomocysteine lyase [EC: 4.4.1.21] (inferred from 94% identity to bhl:Bache_0902)

MetaCyc: 72% identical to S-ribosylhomocysteine lyase monomer (Porphyromonas gingivalis)
S-ribosylhomocysteine lyase. [EC: 4.4.1.21]

Predicted SEED Role

"S-ribosylhomocysteine lyase (EC 4.4.1.21) / Autoinducer-2 production protein LuxS" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.21)

MetaCyc Pathways

• autoinducer AI-2 biosynthesis II (Vibrio) (5/6 steps found)
• autoinducer AI-2 biosynthesis I (4/5 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.21

Protein Sequence (162 amino acids)

>HMPREF1181_RS01210 S-ribosylhomocysteine lyase (Bacteroides stercoris CC31F)
MKKIPSFTIDHIRLLRGIYVSRKDEVNGEVITTFDIRMKEPNREPALGQGALHTIEHLAA
TYLRNEPQWQDKIIYWGPMGCLTGNYLLMKGDLQPQDIVPLMQDTFRFVAGYEGEVPGAA
PQDCGNYLLHDLPMAKWESAKYLHEVLEQMTEENMNYPEKAE