Protein Info for HMPREF1181_RS01205 in Bacteroides stercoris CC31F

Annotation: AMP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 11 to 400 (390 residues), 310.9 bits, E=1.1e-96
• PF13193: AMP-binding_C
  • amino acids 451 to 526 (76 residues), 52.4 bits, E=8.6e-18

Best Hits

Swiss-Prot: 50% identical to YNGI_BACSU: Putative acyl-CoA synthetase YngI (yngI) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 92% identity to bhl:Bache_0903)

Predicted SEED Role

"Acetoacetyl-CoA synthetase (EC 6.2.1.16) / Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Polyhydroxybutyrate metabolism or Biotin biosynthesis or n-Phenylalkanoic acid degradation (EC 6.2.1.16, EC 6.2.1.3)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (47/53 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of fatty acid biosynthesis II (plant) (36/43 steps found)
• long-chain fatty acid activation (1/1 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• γ-linolenate biosynthesis II (animals) (1/2 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• stearate biosynthesis IV (3/6 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• phosphatidylcholine acyl editing (1/4 steps found)
• phytol degradation (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• 3-methyl-branched fatty acid α-oxidation (2/6 steps found)
• fatty acid salvage (2/6 steps found)
• octane oxidation (1/5 steps found)
• 6-gingerol analog biosynthesis (engineered) (1/6 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• 2-deoxy-D-ribose degradation II (2/8 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
• capsaicin biosynthesis (1/7 steps found)
• ceramide degradation by α-oxidation (1/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (2/10 steps found)
• sporopollenin precursors biosynthesis (4/18 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (2/16 steps found)
• cutin biosynthesis (1/16 steps found)
• suberin monomers biosynthesis (2/20 steps found)
• oleate β-oxidation (4/35 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Fatty acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.16 or 6.2.1.3

Protein Sequence (548 amino acids)

>HMPREF1181_RS01205 AMP-binding protein (Bacteroides stercoris CC31F)
MLYERTLGQWLEHWATTTPDKEYIVYSDRNLRFTWSQFNRRVDDMAKGLIAIGVERGTHV
GIWAANVPDWLTLLYACAKIGAVYVTVNTNYKQAELEYLCENSDMHTLCIVNGEKDSDFV
QMTYTMLPELKTCQRGHLKSERFPYMKNVIYVGQEKHRGMYNTSEILLLGDNVEDTRLNE
LKSRVSCHDVVNMQYTSGTTGFPKGVMLTHYNITNNGFLTGEHMKFTAADKLCCCVPLFH
CFGVVLATMNCLTHGCTQVMVERFNPLVVLASIHKERCTALYGVPTMFIAELHHPMFDLF
DMSSLRTGIMAGSLCPVELMKQVEEKMYIKVTSVYGLTEAAPGMTATRIDDSFDVRCNTV
GRDFEHTEVKVIDPETGEECPVGVQGEMCNRGYNTMKGYYKNPQATAEVIDKNGFLHSGD
LGVKDEDGNYRITGRIKDMIIRGGENIYPREIEEFLYQLEGVKDVQVAGIPSKKYGEAVG
AFIIRHEGADLHESDVRDFCIGKISRYKIPKYIFFVKEFPMTGSGKIQKFKLKDIGLQLC
KEQGIEII