Protein Info for HMPREF1181_RS00440 in Bacteroides stercoris CC31F

Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 15 to 167 (153 residues), 204.1 bits, E=5.2e-65
• PF00333: Ribosomal_S5
  • amino acids 16 to 80 (65 residues), 94 bits, E=4.5e-31
• PF03719: Ribosomal_S5_C
  • amino acids 92 to 162 (71 residues), 100 bits, E=4.1e-33

Best Hits

Swiss-Prot: 96% identical to RS5_BACFN: 30S ribosomal protein S5 (rpsE) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 100% identity to bhl:Bache_1073)

MetaCyc: 52% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Protein Sequence (172 amino acids)

>HMPREF1181_RS00440 30S ribosomal protein S5 (Bacteroides stercoris CC31F)
MAGLNNRVKITNDIELKDRLVAINRVTKVTKGGRTFSFSAIVVVGNEEGIIGWGLGKAGE
VTAAIAKGVESAKKNLTKVPVLKGTVPHEQSAKFGGAEVFIKPASHGTGVVAGGAMRAVL
ESVGVTDVLAKSKGSSNPHNLVKATILALSEMRDARMVAQNRGVSMEKVFRG