Protein Info for HMPREF1181_RS00425 in Bacteroides stercoris CC31F

Annotation: preprotein translocase subunit SecY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 73 to 98 (26 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 18 to 426 (409 residues), 381.8 bits, see alignment E=2e-118 PF00344: SecY" amino acids 74 to 416 (343 residues), 372.9 bits, see alignment E=6.9e-116

Best Hits

KEGG orthology group: K03076, preprotein translocase subunit SecY (inferred from 99% identity to bhl:Bache_1076)

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>HMPREF1181_RS00425 preprotein translocase subunit SecY (Bacteroides stercoris CC31F)
MRKAIETLKNIWKIEDLRQRILITILFVAIYRFGSYVVLPGINPSMLTQLHQQTSEGLLA
LLNMFSGGAFSNASIFALGIMPYISASIVIQLLGIAVPYFQKLQREGESGRRKMNQYTRY
LTIIILLVQAPSYLLNLKMQAGPSLNASLDWTLFMLTSTIILAAGSMFILWLGERITDKG
IGNGISLIIMVGIIARLPQSLFQELISRMTDKTGGLVMFLIELVVLLLVIAFAILLVQGT
RKIPVQYAKKIVGNKQYGGARQYIPLKVNAANVMPIIFAQAIMFIPITLVGFSNVNNASG
FIHALTDHTSFWYNLIFAVLIILFTYFYTAITINPTQMAEDMKRNNGFIPGIKPGKQTAE
YIDVIMSRITLPGSFFLALVAIMPAFAGIFGVKAEFAQFFGGTSLLILVGVVLDTLQQVE
SHLLMRHYDGLLKSGRIKGRSGTVAAY