Protein Info for HMPREF1181_RS00230 in Bacteroides stercoris CC31F

Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 7 to 200 (194 residues), 197.2 bits, see alignment E=3.1e-62 PF08659: KR" amino acids 8 to 172 (165 residues), 71.9 bits, see alignment E=1e-23 TIGR01830: 3-oxoacyl-[acyl-carrier-protein] reductase" amino acids 9 to 246 (238 residues), 332.2 bits, see alignment E=1e-103 PF13561: adh_short_C2" amino acids 13 to 247 (235 residues), 240.2 bits, see alignment E=3.7e-75

Best Hits

Swiss-Prot: 54% identical to FABG_STAAR: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain MRSA252)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 96% identity to bhl:Bache_1116)

MetaCyc: 52% identical to 3-oxoacyl-[acyl-carrier-protein] reductase (Bacillus subtilis subtilis 168)
3-oxoacyl-[acyl-carrier-protein] reductase. [EC: 1.1.1.100]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>HMPREF1181_RS00230 3-oxoacyl-[acyl-carrier-protein] reductase (Bacteroides stercoris CC31F)
MGLLDGKTAIVTGAARGIGKAIALKFAQEGANIAFTDLVIDENAEATAKEIETLGVKAKA
YASNAASFEDTAKVVEAIHADFGRIDILVNNAGITRDGLMMRMTEQQWDMVINVNLKSAF
NFIHACTPIMMRQKAGSIINMASVVGVHGNAGQANYSASKAGMIALAKSIAQELGSRGIR
ANAIAPGFIMTAMTDALSEEVKAEWCKKIPLRRGGTPEDVANIATFLASDMSSYVSGQVI
QVDGGMNM