Protein Info for HMPREF1181_RS00035 in Bacteroides stercoris CC31F

Annotation: thiamine diphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR01378: thiamine pyrophosphokinase" amino acids 6 to 199 (194 residues), 149.7 bits, see alignment E=3.8e-48 PF04263: TPK_catalytic" amino acids 21 to 123 (103 residues), 100.6 bits, see alignment E=5.2e-33 PF21275: Thi_PPkinase_C" amino acids 131 to 199 (69 residues), 106.4 bits, see alignment E=5.5e-35

Best Hits

KEGG orthology group: K00949, thiamine pyrophosphokinase [EC: 2.7.6.2] (inferred from 79% identity to bhl:Bache_1170)

Predicted SEED Role

"Thiamin pyrophosphokinase (EC 2.7.6.2)" in subsystem PnuC-like transporters or Thiamin biosynthesis (EC 2.7.6.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>HMPREF1181_RS00035 thiamine diphosphokinase (Bacteroides stercoris CC31F)
MKVEAVVLANGEYPTAPLPLQILADAPYVVCCDGGADEYIRNGHTPNLIIGDGDSISEEN
RKKYGHLLHRIAEQETNDQTKAVNYLLSQGKRRIAIVGATGKREDHTLGNISLLMDYMRA
GADVRTYTDHGIFIPCLNTCTFTCQPGQQVSIINFNARKLHGLGLVYPLSDFTNWWQGTL
NECIGTEFTIEAEGEYLVFLNFPQPLPQSTR