Protein Info for HMPREF1181_RS00035 in Bacteroides stercoris CC31F

Annotation: thiamine diphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01378: thiamine pyrophosphokinase
  • amino acids 6 to 199 (194 residues), 149.7 bits, E=3.8e-48
• PF04263: TPK_catalytic
  • amino acids 21 to 123 (103 residues), 100.6 bits, E=5.2e-33
• PF21275: Thi_PPkinase_C
  • amino acids 131 to 199 (69 residues), 106.4 bits, E=5.5e-35

Best Hits

KEGG orthology group: K00949, thiamine pyrophosphokinase [EC: 2.7.6.2] (inferred from 79% identity to bhl:Bache_1170)

Predicted SEED Role

"Thiamin pyrophosphokinase (EC 2.7.6.2)" in subsystem PnuC-like transporters or Thiamin biosynthesis (EC 2.7.6.2)

MetaCyc Pathways

• thiamine diphosphate salvage III (1/1 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (2/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (2/3 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)
• thiamine diphosphate salvage IV (yeast) (4/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.2

Protein Sequence (211 amino acids)

>HMPREF1181_RS00035 thiamine diphosphokinase (Bacteroides stercoris CC31F)
MKVEAVVLANGEYPTAPLPLQILADAPYVVCCDGGADEYIRNGHTPNLIIGDGDSISEEN
RKKYGHLLHRIAEQETNDQTKAVNYLLSQGKRRIAIVGATGKREDHTLGNISLLMDYMRA
GADVRTYTDHGIFIPCLNTCTFTCQPGQQVSIINFNARKLHGLGLVYPLSDFTNWWQGTL
NECIGTEFTIEAEGEYLVFLNFPQPLPQSTR