Protein Info for HGI48_RS21685 in Dickeya dianthicola 67-19

Annotation: restriction system-associated AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 350 to 365 (16 residues), see Phobius details TIGR04435: restriction system-associated AAA family ATPase" amino acids 1 to 582 (582 residues), 804.1 bits, see alignment E=3.7e-246 PF13304: AAA_21" amino acids 387 to 488 (102 residues), 39.9 bits, see alignment E=2.5e-14

Best Hits

KEGG orthology group: None (inferred from 79% identity to ecq:ECED1_2279)

Predicted SEED Role

"FIG00925693: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJ06 at UniProt or InterPro

Protein Sequence (592 amino acids)

>HGI48_RS21685 restriction system-associated AAA family ATPase (Dickeya dianthicola 67-19)
MKLLRLKITDPAGFRSLPHGFEYHFRTEWSLQEELAQPEGFAPFVCAGPNGSGKSNLLEV
LSAIFFQLEIPRVRTSFLPEALQHADQDFSPVAFELDYLIRIPAEYRNPGGPEWANVSVW
KKPAESVRFRWENQSDFNTDANEAFRGGYADILLPQYVLGYSSGENEILSLPFFKMRFVQ
FDEYWDALTQQRRYPGRPEARLVYLDNGFSQAILLCNLLFQDQATLQPFREDVGIEALQE
FRILIRRSIPLAPEQLPAFASEEQNQSLDDIVNNNPALLADTDDTGNTRYYLNLMRWLEG
DERSSLMVSGLKRCATLYYEDESTDTLVLDYWVNDATRQAFRENFDGSALVLFQAFQVLL
SLNLYTVSDTLKTDLYRSTSHYVSETVPTLASDQRIMRFKNVYFTKQGVEKPMLLKELSD
GEHQLLHSLGLCLLFRETNSLFLLDEPETHFNPHWRASFITRLRQCLPDTGKAGQEMLLT
THTPFLISDSKPGKVLVFAKDNGAVSISKPTYNTLGASINKITMNTFDKRETIGGYAQAL
LDDLRRRFEEGHEDKETLNTEINQRLGDSVEKLLLIKAILDGDQSVNGEVQD