Protein Info for HGI48_RS21595 in Dickeya dianthicola 67-19

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 25 to 52 (28 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 25 to 114 (90 residues), 57.9 bits, see alignment E=5.8e-20 PF00528: BPD_transp_1" amino acids 44 to 224 (181 residues), 79.3 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 91% identity to ddd:Dda3937_01090)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJ17 at UniProt or InterPro

Protein Sequence (252 amino acids)

>HGI48_RS21595 amino acid ABC transporter permease (Dickeya dianthicola 67-19)
MDFSIIRGNFSYLMWGTFPDGPLGGAALTLAISVMAGMVSAVLGTGLGVALAMCRGWAGG
LLAMALGFFRAIPVIMLIFWTYFLLPMLFGVDIPEITTVVCALGLIASAYLAHGVKAGIA
AIGRGQWQAGMSLGLGRWQTLWYIVLPQALRMMAPSFINQWISLIKDTSLAYIVGVGELT
FLATQVNNRSMVYPTEVFLFIALVYFIFCLSLDLLAQGVSRRFRAGPKSARRRLFGGRKP
AGAPESPLRESA