Protein Info for HGI48_RS21575 in Dickeya dianthicola 67-19

Annotation: phosphate ABC transporter ATP-binding protein PstB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 12 to 258 (247 residues), 401.7 bits, see alignment E=5.5e-125 PF00005: ABC_tran" amino acids 27 to 182 (156 residues), 126.7 bits, see alignment E=1e-40

Best Hits

Swiss-Prot: 96% identical to PSTB2_PECAS: Phosphate import ATP-binding protein PstB 2 (pstB2) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 99% identity to ddc:Dd586_4186)

MetaCyc: 91% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJI6 at UniProt or InterPro

Protein Sequence (258 amino acids)

>HGI48_RS21575 phosphate ABC transporter ATP-binding protein PstB (Dickeya dianthicola 67-19)
MSMVTETFASKIQVRNLNFYYGKFHALKNITLDIAKNQVTAFIGPSGCGKSTLLRTLNKM
YQLYPEQRAEGDILLDGNNILTDNQDIALLRAKVGMVFQKPTPFPMSIYDNIAFGVKLFE
KLSRAEMDERVQWALTKAALWQETKDKLHQSGYSLSGGQQQRLCIARGIAIRPDVLLLDE
PCSALDPISTGRIEELISELKKDYTVVIVTHNMQQAARCSDHTAFMYLGELIEFSDTDTL
FTAPRQKQTEDYITGRYG