Protein Info for HGI48_RS21495 in Dickeya dianthicola 67-19

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 274 to 292 (19 residues), see Phobius details amino acids 481 to 499 (19 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 10 to 143 (134 residues), 60.8 bits, see alignment E=8.4e-21

Best Hits

KEGG orthology group: None (inferred from 92% identity to ddc:Dd586_4173)

Predicted SEED Role

"FIG143263: Glycosyl transferase / Lysophospholipid acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RIZ1 at UniProt or InterPro

Protein Sequence (569 amino acids)

>HGI48_RS21495 glycosyltransferase family 2 protein (Dickeya dianthicola 67-19)
MSMNREFSPCVVIPCYNHGAMMHSVLTRLAPFGLPVLIVDDGSDDATRQALFRLTNEFAN
VTLFRLTPNSGKGAAVMHGLAMAADAGYSHALQIDADGQHHIEDTPRMLAQARAWPDCLI
SGRPLYDASVPRSRLYGRYVTHVWVWIETLSLSLKDSMCGFRVYPIAPTLALSAQRAIGR
RMDFDTEIMVRLYWGGTFSRFVPTRVVYPENGVSHFDALRDNLRISWMHTRLFFGMLPRI
PSLLKHRREPHWAAINERKGMLGMRFMLQVYRWFGRRAFTLLLWPVIAFYWLTGGPQRKA
SQHWLRAVRLYARRHHVGLPRPLTSYHHFLRFGHAMIDKIASWRGDLQWGRDIDFAPGAL
DAINQGRQRGQLILASHLGDIEVCRGLAGKVSGLVINALVFTDNAQRFRQLQEAVAPQAG
VNLMPVSDIGPDTAILLQQKLDAGEWVAIVGDRTAVNRQRGGGRRVVWSPFLGRPAPFPQ
GPFVLAAALRCPVLLMFAIRERGKLRVYCEPFADPILLPRAHRQSALQQVVDRYAERLEH
HALKAPLDWFNFFDFWQLSDDTPTDRENT