Protein Info for HGI48_RS21445 in Dickeya dianthicola 67-19

Annotation: glutamine--fructose-6-phosphate transaminase (isomerizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)" amino acids 2 to 611 (610 residues), 866.2 bits, see alignment E=6.3e-265 PF13230: GATase_4" amino acids 60 to 145 (86 residues), 24.7 bits, see alignment E=2.2e-09 PF13522: GATase_6" amino acids 67 to 184 (118 residues), 63.4 bits, see alignment E=4.7e-21 PF13537: GATase_7" amino acids 81 to 197 (117 residues), 52.1 bits, see alignment E=1.3e-17 PF01380: SIS" amino acids 291 to 419 (129 residues), 115.3 bits, see alignment E=3.5e-37 amino acids 463 to 593 (131 residues), 91.6 bits, see alignment E=7.7e-30

Best Hits

Swiss-Prot: 90% identical to GLMS_PECAS: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 98% identity to ddd:Dda3937_00141)

MetaCyc: 84% identical to L-glutamine--D-fructose-6-phosphate aminotransferase (Escherichia coli K-12 substr. MG1655)
Glutamine--fructose-6-phosphate transaminase (isomerizing). [EC: 2.6.1.16]

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RIX2 at UniProt or InterPro

Protein Sequence (611 amino acids)

>HGI48_RS21445 glutamine--fructose-6-phosphate transaminase (isomerizing) (Dickeya dianthicola 67-19)
MCGIVGAVAQRDIAEILLEGLRRLEYRGYDSAGLAVLNGEGQVSRLRRLGKVQVLAQAAE
EQPLVGGTGIAHTRWATHGEPSEQNAHPHVSEHIIVVHNGIIENHEPLRELMVSRGYRFV
SETDTEVVAHLMHWEQQQNGGSLLEVVQRVIPQLRGAYGMVLLDSRDPNVLVAARSGSPL
VIGRGVGENFIASDQLALLPVTRRFIFLEEGDIAEVTRRTVRIVNRQGQDVNRDEIESKV
QYDAGDKGAYRHYMQKEIYEQPMAIKNTLEGRFSHGEINLSELGPQADALLAQVQHIQII
ACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKPALRANSLMITLSQSGETADTLAA
LRLSKDLGYLGSLAICNVAGSSLVRESDLALMTRAGTEIGVASTKAFTTQLTVLLMLVAR
IGRLRGMDARIEHDIVHALQALPARIEQMLSQDKLIESLAEGFSDKHHALFLGRGDQYPI
AMEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVVVVAPNNDLLEKLKSNIEEVRA
RGGELYVFADEQAGFTSESDMMKIIQLPHVEEVIAPIFYTVPLQLLSYHVALIKGTDVDQ
PRNLAKSVTVE