Protein Info for HGI48_RS21310 in Dickeya dianthicola 67-19

Annotation: ribose operon transcriptional repressor RbsR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF00356: LacI" amino acids 1 to 45 (45 residues), 75 bits, see alignment 6.5e-25 PF00532: Peripla_BP_1" amino acids 57 to 305 (249 residues), 119.5 bits, see alignment E=4e-38 PF13407: Peripla_BP_4" amino acids 59 to 301 (243 residues), 76 bits, see alignment E=7.4e-25 PF13377: Peripla_BP_3" amino acids 167 to 327 (161 residues), 149.2 bits, see alignment E=2.5e-47

Best Hits

Swiss-Prot: 69% identical to RBSR_ECOLI: Ribose operon repressor (rbsR) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 96% identity to ddd:Dda3937_02360)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJT6 at UniProt or InterPro

Protein Sequence (331 amino acids)

>HGI48_RS21310 ribose operon transcriptional repressor RbsR (Dickeya dianthicola 67-19)
MKDVARLAGVSTSTVSHVINNNRYVSDAIRYRVMKAVEQLNYAPSALARSLKINQTRTIG
MLLTASSNPFYAEVVRGVERCCYERGYSLILCNTEGDHHRLSRSLETLLQKRVDGLLLMC
TESHMPSPDIIRRYPSIPVVMMDWAPFEGSSDVIKDNSLQGGEMATHHLISQGYRNIACI
AGPQDKTTAHNRLEGYRKAMHQAGLSILPGYEVIGDFEFETGFRAMQQLLALPERPDAVF
TSNDAMAVGVYRALYEAGLSIPDDMAVVGYDDIELARYLSPPLTTIHQPKDELGELAIDT
LFHRLEYPDAEHNVLVLTPELIIRDSVGKRS