Protein Info for HGI48_RS21215 in Dickeya dianthicola 67-19

Annotation: glucose-1-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF00702: Hydrolase" amino acids 2 to 178 (177 residues), 57.1 bits, see alignment E=4.9e-19 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 60 to 184 (125 residues), 58.7 bits, see alignment E=3.9e-20 PF13419: HAD_2" amino acids 85 to 184 (100 residues), 39.1 bits, see alignment E=1.4e-13 PF13242: Hydrolase_like" amino acids 140 to 185 (46 residues), 24.6 bits, see alignment 2.8e-09

Best Hits

Swiss-Prot: 64% identical to YIHX_ECOLI: Alpha-D-glucose 1-phosphate phosphatase YihX (yihX) from Escherichia coli (strain K12)

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 95% identity to ddd:Dda3937_01120)

MetaCyc: 64% identical to alpha-D-glucose-1-phosphate phosphatase YihX (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphatase. [EC: 3.1.3.10]

Predicted SEED Role

"Alpha-D-glucose-1-phosphatase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RIY7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>HGI48_RS21215 glucose-1-phosphatase (Dickeya dianthicola 67-19)
MLYIFDLGNVIIDIDFNRVLGVWSNLSGAPLAALRERFVQGRTFEEHERGEISDEEFASR
FSHELGMTLSFEQFSTGWQAIFIGVRKDVIDIMHRLRQEGHRVVILSNTNRLHCQFWPDE
YPEVQQAVDRLYLSQDIGQRKPEAAIYHHVLREEGVDASDALFFDDNAANVDAANALGIR
SILVSDRQVVPDFFASQVFKQES