Protein Info for HGI48_RS20640 in Dickeya dianthicola 67-19

Annotation: sn-glycerol-3-phosphate ABC transporter permease UgpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 81 to 106 (26 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 277 (183 residues), 71.3 bits, see alignment E=4.5e-24

Best Hits

Swiss-Prot: 83% identical to UGPE_PECAS: sn-glycerol-3-phosphate transport system permease protein UgpE (ugpE) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 95% identity to dze:Dd1591_4043)

MetaCyc: 74% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJT0 at UniProt or InterPro

Protein Sequence (282 amino acids)

>HGI48_RS20640 sn-glycerol-3-phosphate ABC transporter permease UgpE (Dickeya dianthicola 67-19)
MIENRRGLDIFSHAMLVVAIVAVLFPLYIAFIAATLSQQQMSQVPMQLIPGGHLWENMTS
IWRHGVGDNNSAPFGLMLFNSFVMALAITVGKISVSMLSAFAIVYFRFPCRNLFFWMIFS
TLMLPVEVRIFPTVEVISHLNMTNSYVGLTLPVMASATATFLFRQFFMTLPNELLEAARI
DGASPMRFFFDMVLPLSKTNLAALFVITFIYGWNQYLWPLLIVNDARLGTAVAGIQSMIA
TGDTATPWHQVMAAMLMTMLPPLLVVLLMQRWFVRGLVDSEK