Protein Info for HGI48_RS20525 in Dickeya dianthicola 67-19

Annotation: N-carbamoylputrescine amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03381: N-carbamoylputrescine amidase
  • amino acids 4 to 284 (281 residues), 476.4 bits, E=1.4e-147
• PF00795: CN_hydrolase
  • amino acids 5 to 268 (264 residues), 194.9 bits, E=7.8e-62

Best Hits

Swiss-Prot: 60% identical to AGUB_SOLLC: N-carbamoylputrescine amidase (CPA) from Solanum lycopersicum

KEGG orthology group: K12251, N-carbamoylputrescine amidase [EC: 3.5.1.53] (inferred from 98% identity to ddd:Dda3937_03868)

MetaCyc: 64% identical to N-carbamoylputrascine amidohydrolase subunit (Pseudomonas aeruginosa)
N-carbamoylputrescine amidase. [EC: 3.5.1.53]

Predicted SEED Role

"N-carbamoylputrescine amidase (3.5.1.53)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism

MetaCyc Pathways

• superpathway of polyamine biosynthesis II (7/8 steps found)
• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
• putrescine biosynthesis II (3/3 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.53

Sequence Analysis Tools

See A0A7L9RJ14 at UniProt or InterPro

Protein Sequence (294 amino acids)

>HGI48_RS20525 N-carbamoylputrescine amidase (Dickeya dianthicola 67-19)
MTKVTVAATQMACTWDLPKNIENAERLVRQAHAQGAQIILIQELFAAPYFCIDQSPEHYA
LAQELATSELIKHFSALAAELDVVLPLSFFERANNAYYNSLVMIDADGSVLDVYRKTHIP
NGPAYQEKQFFIPGDTGFKVWQTRYAKVGVGICWDQWFPETARCLALNGAELIFYPTAIG
SEPAYPDIDSQPHWTRVQQGHAAANLIPVIASNRIGTEASKYIDGLEMTFYGSSFIADQT
GALVAQANKTDETVLVHEFSLDAIAAQRASWGLFRDRRPDMYGVIGTSDGKTWR