Protein Info for HGI48_RS20465 in Dickeya dianthicola 67-19

Annotation: 1,4-dihydroxy-2-naphthoate polyprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 234 to 265 (32 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details TIGR00751: 1,4-dihydroxy-2-naphthoate octaprenyltransferase" amino acids 18 to 301 (284 residues), 416.7 bits, see alignment E=2.5e-129 PF01040: UbiA" amino acids 28 to 265 (238 residues), 111.1 bits, see alignment E=2.9e-36

Best Hits

Swiss-Prot: 72% identical to MENA_ECOLI: 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA) from Escherichia coli (strain K12)

KEGG orthology group: K02548, 1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC: 2.5.1.- 2.5.1.74] (inferred from 95% identity to dze:Dd1591_0112)

MetaCyc: 72% identical to 1,4-dihydroxy-2-naphthoate octaprenyltransferase (Escherichia coli K-12 substr. MG1655)
DMK-RXN [EC: 2.5.1.74]

Predicted SEED Role

"1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)" (EC 2.5.1.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RIF5 at UniProt or InterPro

Protein Sequence (305 amino acids)

>HGI48_RS20465 1,4-dihydroxy-2-naphthoate polyprenyltransferase (Dickeya dianthicola 67-19)
MTQLTHSSKTQAWLDSLRPKTLPLAFASIVTGTVIACWHSNFKPGVALLTLITAGLLQIL
SNLANDYGDAVKGSDKEDRIGPLRGIQTGTISLPELRNALLITVTLTAISGSALVALACE
KPVDIVVFLSLGLLAILAAITYTVGNKPYGYIGLGDISVLIFFGWLSVAGSYYLQTGHFD
SSVILPATACGLLAVAVLNINNLRDIDSDRENGKNTLAVRLGARTARRYHMALLMTAPIC
LALFAMLYLHTLAGWLFILALPLLVKQGRYVMRETTAFSMRPMLEKTVKGALLTNLLFAV
GVLLS