Protein Info for HGI48_RS20220 in Dickeya dianthicola 67-19

Annotation: thioredoxin TrxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 5 to 105 (101 residues), 117.6 bits, E=5.8e-38
• TIGR01068: thioredoxin
  • amino acids 9 to 107 (99 residues), 131.2 bits, E=6.9e-43
• PF13098: Thioredoxin_2
  • amino acids 19 to 104 (86 residues), 33.5 bits, E=1.2e-11
• PF13728: TraF
  • amino acids 20 to 102 (83 residues), 23.2 bits, E=1.4e-08

Best Hits

Swiss-Prot: 89% identical to THIO_SALTI: Thioredoxin 1 (trxA) from Salmonella typhi

KEGG orthology group: K03671, thioredoxin 1 (inferred from 98% identity to ddd:Dda3937_00266)

MetaCyc: 89% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

• periplasmic disulfide bond reduction (2/2 steps found)
• cytochrome c biogenesis (system I type) (4/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

See A0A7L9RIW6 at UniProt or InterPro

Protein Sequence (108 amino acids)

>HGI48_RS20220 thioredoxin TrxA (Dickeya dianthicola 67-19)
MSDKIIHLTDDSFETDVLQSEHVTLVDFWADWCGPCKMIAPILDEIADEYDGKLTVAKLN
IDDNPATAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLNANL