Protein Info for HGI48_RS20075 in Dickeya dianthicola 67-19

Annotation: hydroxymethylbilane synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 82% identical to HEM3_ENT38: Porphobilinogen deaminase (hemC) from Enterobacter sp. (strain 638)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 97% identity to ddd:Dda3937_00293)

MetaCyc: 81% identical to hydroxymethylbilane synthase (Escherichia coli K-12 substr. MG1655)
Hydroxymethylbilane synthase. [EC: 2.5.1.61]

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

superpathway of heme b biosynthesis from glutamate (10/10 steps found)
tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
superpathway of heme b biosynthesis from glycine (7/8 steps found)
dipyrromethane cofactor biosynthesis (3/4 steps found)
tetrapyrrole biosynthesis II (from glycine) (3/4 steps found)
adenosylcobalamin biosynthesis II (aerobic) (13/33 steps found)
superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (12/36 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RIA3 at UniProt or InterPro

Protein Sequence (313 amino acids)

>HGI48_RS20075 hydroxymethylbilane synthase (Dickeya dianthicola 67-19)
MVDTILRIATRQSPLALWQTHFVQQRLEACHPGLRVELVPMVTRGDVLLDTPLAKVGGKG
LFVKELELALLENRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNHYATLDELP
VGACVGTSSLRRQCQLRAHRPDLKVRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLGLE
DRIRTALSPEQSLPAVGQGAVGVECRLDDARTRALLAPLNHDDTATRVLAERAMNTRLEG
GCQVPIGSYAELQGGDMLWLRALVGAPDGSRIIYAERRGLRQDAEQLGIDLANELLERGA
RDILQSVYGEASS