Protein Info for HGI48_RS19950 in Dickeya dianthicola 67-19

Annotation: pirin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02678: Pirin
  • amino acids 8 to 119 (112 residues), 131.3 bits, E=1.5e-42
• PF17954: Pirin_C_2
  • amino acids 143 to 228 (86 residues), 102.2 bits, E=1.5e-33

Best Hits

Swiss-Prot: 77% identical to YHHW_ECOLI: Quercetin 2,3-dioxygenase (yhhW) from Escherichia coli (strain K12)

KEGG orthology group: K06911, (no description) (inferred from 98% identity to ddd:Dda3937_00320)

MetaCyc: 77% identical to quercetin 2,3-dioxygenase (Escherichia coli K-12 substr. MG1655)
Quercetin 2,3-dioxygenase. [EC: 1.13.11.24]

Predicted SEED Role

"Qercetin 2,3-dioxygenase"

MetaCyc Pathways

• rutin degradation (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.24

Sequence Analysis Tools

See A0A7L9RI52 at UniProt or InterPro

Protein Sequence (232 amino acids)

>HGI48_RS19950 pirin family protein (Dickeya dianthicola 67-19)
MIYLRKAQDRGHANHGWLDSWHTFSFADYYDPDFMGFSALRVINEDRIEGGQGFGTHPHR
DMEILTYVLQGSVEHQDSMGNKEQIPAGEFQIMSAGTGIRHSEYNASQDELLHLYQIWVI
PEKTGLTPRYEQRRFDARQGRQLVLSPDARDGSLKVFQDMTLWRWALKSQEESVYQTQQG
RHLWIQVVRGTIEINGQQATASDALAIWDEDSITVRAGEDSEILLFDLPPVK