Protein Info for HGI48_RS19870 in Dickeya dianthicola 67-19

Annotation: nickel-responsive transcriptional regulator NikR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF01402: RHH_1" amino acids 3 to 41 (39 residues), 37.4 bits, see alignment E=1.7e-13 PF08753: NikR_C" amino acids 54 to 130 (77 residues), 103.2 bits, see alignment E=7.1e-34

Best Hits

Swiss-Prot: 52% identical to NIKR_ECO27: Nickel-responsive regulator (nikR) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K07722, CopG family transcriptional regulator, nickel-responsive regulator (inferred from 95% identity to ddd:Dda3937_00327)

Predicted SEED Role

"Nickel responsive regulator NikR" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RIM0 at UniProt or InterPro

Protein Sequence (145 amino acids)

>HGI48_RS19870 nickel-responsive transcriptional regulator NikR (Dickeya dianthicola 67-19)
MQRLTISLDDPLAEALDALMLRKGYANRSEAFRDMLRRELGEMTVAQDKNAGCVAVLSYV
YDHHERQLSSRLAGMQHEHHHLTVSTMHTHLSHDECVETVILRGPTERVEQFAASVIAQT
GVRHGRLNLIPMDNAATGAEPSKHM