Protein Info for HGI48_RS19720 in Dickeya dianthicola 67-19

Annotation: intracellular growth attenuator family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 652 to 677 (26 residues), see Phobius details PF07095: IgaA" amino acids 1 to 701 (701 residues), 1149.6 bits, see alignment E=0

Best Hits

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00361)

Predicted SEED Role

"IgaA: a membrane protein that prevents overactivation of the Rcs regulatory system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RI26 at UniProt or InterPro

Protein Sequence (709 amino acids)

>HGI48_RS19720 intracellular growth attenuator family protein (Dickeya dianthicola 67-19)
MRTILIILAVLFACLIAVGGIIGYLMYRRLLFAKRLPVTPSGHRQLTASERIAIERYLAM
SHLDGPVSSSVSVASPRLPRLLPGNRVYPITHSITRYGLSTDAPNKWRYYIDTQEIHLPA
RWEQYITQNNEIEIIKTRSIPLVVSLNGHSVTEFINEMDSSAGADIPGEQASIRPEIHEH
TELVAIRRETLEEHAVHRSRGLRESGVLSLAFLLLVFSLTSPLAILPWLAGAACLMAGWG
CWQLFRPPSQKELREVHCLHGTPQCMGLFSDTSQSQIGNVSLGNIDLIYPPHWQPYIGYD
LGRKTDVDIYLTRQVVRQGHYLSLHNEVKFFPLQQWGKNAVLAAGALLSLILLLTSVPLD
LPLKLSLAWVQGASSVKVTQVEELERMPLHIGDKLQVHGAGMCYVPPINLNPASSRASAF
APFDCAAIYWNKAAPLPLPESDTIEKTAALQKTVNEQLHPAASDNQVSSQLADAIQKSGM
ILLNNFSDIVLKTDALCEKEEDCTRLKNALINLGNARNWELLVKRARSGALKGTSVVLRP
VSAESLDSLVKNATDEFYSREIITASNLLNSPPPGGFLIRSDEGRQFINHPMPATPLRDF
PPQEQWQELQRLSSLLLHTPFEANGVITQLSIDANGTRHISLHSEPDAVTMWRSLGACLL
LLAFSVILILNLVLLLVKRRRSQQRIANIQQYYARHLVPETPAATAMYG