Protein Info for HGI48_RS19575 in Dickeya dianthicola 67-19

Annotation: aminodeoxychorismate synthase component II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 1 to 190 (190 residues), 302.6 bits, E=5.7e-95
• PF00117: GATase
  • amino acids 3 to 189 (187 residues), 213.4 bits, E=2.3e-67
• PF07722: Peptidase_C26
  • amino acids 70 to 174 (105 residues), 29.8 bits, E=5e-11

Best Hits

Swiss-Prot: 80% identical to PABA_SERMA: Aminodeoxychorismate synthase component 2 (pabA) from Serratia marcescens

KEGG orthology group: K01664, para-aminobenzoate synthetase component II [EC: 2.6.1.85] (inferred from 95% identity to ddd:Dda3937_00548)

MetaCyc: 77% identical to aminodeoxychorismate synthase subunit 2 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

See A0A7L9RHZ0 at UniProt or InterPro

Protein Sequence (191 amino acids)

>HGI48_RS19575 aminodeoxychorismate synthase component II (Dickeya dianthicola 67-19)
MLLLIDNYDSFTYNLYQYFCELGAEVLVRRNDALTLADIEQLAPRRLVISPGPCTPDDAG
ISLAAIRHFAGTLPIFGVCLGHQALGQAFGARVVRARQVMHGKTSPVRHTGCGVFAGLAN
PLTVTRYHSLVLEKDSLPDCFEVTAWTENDAGMDEIMGVRHRSLPLEGVQFHPESILSQQ
GHQLLRNFLDL