Protein Info for HGI48_RS19560 in Dickeya dianthicola 67-19

Annotation: OsmC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF02566: OsmC" amino acids 30 to 137 (108 residues), 64.9 bits, see alignment E=3.9e-22

Best Hits

KEGG orthology group: K07397, putative redox protein (inferred from 87% identity to ddc:Dd586_3765)

Predicted SEED Role

"OsmC/Ohr family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RI06 at UniProt or InterPro

Protein Sequence (145 amino acids)

>HGI48_RS19560 OsmC family protein (Dickeya dianthicola 67-19)
MQARVKWVEGLTFLGESASGHQLLMDGNAGDKAPSPMEMVLMAAGGCSAIDVVSILQKGR
YDVAGCEVRLTSERREEAPRLFTAINLHFIVTGKTVTGKIVTGKELNDKAVERAVSLSAE
KYCSVALMLGKAVNITHSHEVVALD