Protein Info for HGI48_RS19550 in Dickeya dianthicola 67-19

Annotation: YheU family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 76 PF06794: UPF0270" amino acids 1 to 68 (68 residues), 119.3 bits, see alignment E=3e-39

Best Hits

Swiss-Prot: 81% identical to YHEU_ESCF3: UPF0270 protein YheU (yheU) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K09898, hypothetical protein (inferred from 93% identity to ddd:Dda3937_00543)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RIF9 at UniProt or InterPro

Protein Sequence (76 amino acids)

>HGI48_RS19550 YheU family protein (Dickeya dianthicola 67-19)
MIIPWQELAQETLQNLIESFVLREGTDYGEQERTLEEKVADIRRQLAQGDVVLVWSELHE
TVNIMPRNPLSSSERY