Protein Info for HGI48_RS18725 in Dickeya dianthicola 67-19

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 258 to 283 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 67 to 182 (116 residues), 49.7 bits, see alignment E=2.2e-17 PF00528: BPD_transp_1" amino acids 92 to 285 (194 residues), 57.2 bits, see alignment E=9.7e-20

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 97% identity to ddd:Dda3937_00458)

Predicted SEED Role

"Amino acid ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RHM0 at UniProt or InterPro

Protein Sequence (313 amino acids)

>HGI48_RS18725 amino acid ABC transporter permease (Dickeya dianthicola 67-19)
MTPSIHPSLPHNPADVPTTPLRVVPARYPLRIAGALFSLFIFAGIAESVALNSRWEWPVF
ASYFFNPVILEGLGRTLLLTLLGTLFSIVAGTGLALARLSSSTLLSTLAWLYIWLFRSLP
LILVLIILYNFSYLYDALALGIPFTSIEFFRYPTIDVLGPFAVAVLGLTLVQSAYTAEII
RGGILGVDAGQFEAAAALGLPGYRRTWRIILPQALRSILPTGFNEIISLAKGTSVVYVLA
LPELFYTVQVIYNRTQQVIPLLMVATAWYLVITSVLSVLQYFVERYVARGAVRETPTHPL
RRLFQRLSARRRR