Protein Info for HGI48_RS18690 in Dickeya dianthicola 67-19

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details PF00892: EamA" amino acids 5 to 138 (134 residues), 67.5 bits, see alignment E=7.1e-23 amino acids 160 to 288 (129 residues), 37.3 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 84% identity to kva:Kvar_4116)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RI75 at UniProt or InterPro

Protein Sequence (304 amino acids)

>HGI48_RS18690 DMT family transporter (Dickeya dianthicola 67-19)
MNARRGICLKILSTLCATLMLACVKGLQGAIPTGEVIFFRSFVAMFPLLIWLKIQGNIIA
SIKTKNLFGHLVRGFSGTGGMYFNYLALVYLSLADATAISYAAPLFTVIMAALLLKEKVH
VARWLGVVVGFSGILIMLSANLTAGGAMLAHSGLQSGMGLGALFALLAALCSATSNVQIR
FLNGIEKPGAIVFYFSLMTTLIGLATITLGWSMPTPLQLLLLIGCGFFGGMTQILVTLSL
RYTDASLLAPFDYTTLVWSMMIGYLFLNNFPGPATLLGASIVALAGIFTLWCDQRRARIM
HSTS