Protein Info for HGI48_RS18605 in Dickeya dianthicola 67-19

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 158 to 177 (20 residues), see Phobius details PF00005: ABC_tran" amino acids 49 to 179 (131 residues), 74.5 bits, see alignment E=6.7e-25

Best Hits

KEGG orthology group: K09691, lipopolysaccharide transport system ATP-binding protein (inferred from 96% identity to ddd:Dda3937_00446)

Predicted SEED Role

"Nitrate ABC transporter, ATP-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1X8 at UniProt or InterPro

Protein Sequence (243 amino acids)

>HGI48_RS18605 ABC transporter ATP-binding protein (Dickeya dianthicola 67-19)
MKKIIEAVNVSVEFPIYSSSQRSLKKMLFKRTVGGGFSDSTSYVTVKALNNVSFDVHEGE
RVALIGHNGAGKTTLLRVLAGVYHPSSGAINIAGEVVSLIDMAMGMDSEATGYQNIYIRG
ILLGLRRKDIAKHIDYIIEFSELGDYIHLPVRTYSSGMLLRLAFSIISILNPSVLLMDEW
LTVGDTYFREKMGKKLEEMINNTSVLVLASHSKDIIKKYCNRFLLLQNGSITELALSDID
NYL